Lineage for d1ncoa_ (1nco A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.7: Actinoxanthin-like [49319] (1 family) 
Family b.1.7.1: Actinoxanthin-like [49320] (4 proteins) Protein Neocarzinostatin [49323] (1 species) Species Streptomyces carzinostaticus [TaxId:1897] [49324] (2 PDB entries) 
Domain d1ncoa_: 1nco A: [22209]
Details for d1ncoa_
PDB Entry: 1nco (more details), 1.8 Å
PDB Description: structure of the antitumor protein-chromophore complex neocarzinostatin
SCOP Domain Sequences for d1ncoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ncoa_ b.1.7.1 (A:) Neocarzinostatin {Streptomyces carzinostaticus}
aaptatvtpssglsdgtvvkvagaglqagtaydvgqcawvdtgvlacnpadfssvtadan
gsastsltvrrsfegflfdgtrwgtvdcttaacqvglsdaagngpegvaisfn
SCOP Domain Coordinates for d1ncoa_:
Click to download the PDB-style file with coordinates for d1ncoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ncoa_:
- d1ncoa_ appears in SCOP 1.57
- d1ncoa_ appears in the current release, SCOPe 2.08
View in 3D
