SCOPe 2.08: Domain d4gq0a1: 4gq0 A:1-316

Lineage for d4gq0a1 (4gq0 A:1-316)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein Aldose reductase (aldehyde reductase) [51436] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51437] (156 PDB entries)
   Uniprot P15121

8. Domain d4gq0a1: 4gq0 A:1-316 [222084]
   Other proteins in same PDB: d4gq0a2
   complexed with nap, qap

Details for d4gq0a1

PDB Entry: 4gq0, 2.1 Å

PDB Description: Crystal structure of AKR1B10 complexed with NADP+ and Caffeic acid phenethyl ester

PDB Compounds: (A:) Aldo-keto reductase family 1 member B10

SCOPe Domain Sequences for d4gq0a1:

Sequence; same for both SEQRES and ATOM records:

>d4gq0a1 c.1.7.1 (A:1-316) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]}
matfvelstkakmpivglgtwksplgkvkeavkvaidagyrhidcayvyqnehevgeaiq
ekiqekavkredlfivsklwptfferplvrkafektlkdlklsyldvylihwpqgfksgd
dlfpkddkgnaiggkatfldaweameelvdeglvkalgvsnfshfqiekllnkpglkykp
vtnqvechpyltqekliqychskgitvtaysplgspdrpwakpedpslledpkikeiaak
hkktaaqvlirfhiqrnvivipksvtpariveniqvfdfklsdeematilsfnrnwracn
vlqsshledypfdaey

Timeline for d4gq0a1:

• d4gq0a1 first appeared in SCOPe 2.03, called d4gq0a_
  
• d4gq0a1 appears in SCOPe 2.07