Lineage for d4gq0a_ (4gq0 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1338786Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 1338787Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 1339058Protein automated matches [190169] (4 species)
    not a true protein
  7. 1339059Species Human (Homo sapiens) [TaxId:9606] [188399] (51 PDB entries)
  8. 1339112Domain d4gq0a_: 4gq0 A: [222084]
    automated match to d3qkza_
    complexed with nap, qap

Details for d4gq0a_

PDB Entry: 4gq0 (more details), 2.1 Å

PDB Description: Crystal structure of AKR1B10 complexed with NADP+ and Caffeic acid phenethyl ester
PDB Compounds: (A:) Aldo-keto reductase family 1 member B10

SCOPe Domain Sequences for d4gq0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gq0a_ c.1.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shmatfvelstkakmpivglgtwksplgkvkeavkvaidagyrhidcayvyqnehevgea
iqekiqekavkredlfivsklwptfferplvrkafektlkdlklsyldvylihwpqgfks
gddlfpkddkgnaiggkatfldaweameelvdeglvkalgvsnfshfqiekllnkpglky
kpvtnqvechpyltqekliqychskgitvtaysplgspdrpwakpedpslledpkikeia
akhkktaaqvlirfhiqrnvivipksvtpariveniqvfdfklsdeematilsfnrnwra
cnvlqsshledypfdaey

SCOPe Domain Coordinates for d4gq0a_:

Click to download the PDB-style file with coordinates for d4gq0a_.
(The format of our PDB-style files is described here.)

Timeline for d4gq0a_: