Lineage for d4gcia1 (4gci A:1-81)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880580Species Yersinia pestis [TaxId:632] [226438] (3 PDB entries)
  8. 2880581Domain d4gcia1: 4gci A:1-81 [221836]
    Other proteins in same PDB: d4gcia2, d4gcia3, d4gcib2, d4gcib3
    automated match to d1n2aa2
    complexed with cl, gsh

Details for d4gcia1

PDB Entry: 4gci (more details), 1.5 Å

PDB Description: Crystal structure of glutahtione s-transferase homolog from yersinia pestis, target EFI-501894, with bound glutathione, monoclinic form
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d4gcia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gcia1 c.47.1.0 (A:1-81) automated matches {Yersinia pestis [TaxId: 632]}
mmklfykpgacslsphivlreagldfsiervdlvtkktetgadylsinpkgqvpalvldd
gslltegvaivqyladkvpdr

SCOPe Domain Coordinates for d4gcia1:

Click to download the PDB-style file with coordinates for d4gcia1.
(The format of our PDB-style files is described here.)

Timeline for d4gcia1: