SCOPe 2.08: Domain d4gcia1: 4gci A:1-81

Lineage for d4gcia1 (4gci A:1-81)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [226438] (3 PDB entries)

8. Domain d4gcia1: 4gci A:1-81 [221836]
   Other proteins in same PDB: d4gcia2, d4gcia3, d4gcib2, d4gcib3
   automated match to d1n2aa2
   complexed with cl, gsh

Details for d4gcia1

PDB Entry: 4gci, 1.5 Å

PDB Description: Crystal structure of glutahtione s-transferase homolog from yersinia pestis, target EFI-501894, with bound glutathione, monoclinic form

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d4gcia1:

Sequence; same for both SEQRES and ATOM records:

>d4gcia1 c.47.1.0 (A:1-81) automated matches {Yersinia pestis [TaxId: 632]}
mmklfykpgacslsphivlreagldfsiervdlvtkktetgadylsinpkgqvpalvldd
gslltegvaivqyladkvpdr

Timeline for d4gcia1:

• d4gcia1 first appeared in SCOPe 2.03
  
• d4gcia1 appears in SCOPe 2.07