| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
| Protein automated matches [226831] (73 species) not a true protein |
| Species Yersinia pestis [TaxId:632] [226439] (3 PDB entries) |
| Domain d4gcib2: 4gci B:82-201 [221839] Other proteins in same PDB: d4gcia1, d4gcia3, d4gcib1, d4gcib3 automated match to d1n2aa1 complexed with cl, gsh |
PDB Entry: 4gci (more details), 1.5 Å
SCOPe Domain Sequences for d4gcib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gcib2 a.45.1.0 (B:82-201) automated matches {Yersinia pestis [TaxId: 632]}
hliapsgtlsryhaiewlnfiatelhkgfsplfnpntpdeyktivrerldkqfsyvdsvl
aehdyllgkkfsvadaylftvsrwanalnlqikershldqymarvaerpavkaalaaedi
Timeline for d4gcib2: