Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
Protein automated matches [190896] (11 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188315] (105 PDB entries) |
Domain d4fxvd1: 4fxv D:20-96 [221595] Other proteins in same PDB: d4fxva2, d4fxvb2, d4fxvc2, d4fxvd2 automated match to d2cpja1 |
PDB Entry: 4fxv (more details), 1.9 Å
SCOPe Domain Sequences for d4fxvd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fxvd1 d.58.7.0 (D:20-96) automated matches {Human (Homo sapiens) [TaxId: 9606]} tnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdaerain tlnglrlqsktikvsya
Timeline for d4fxvd1: