Lineage for d4fxvb1 (4fxv B:20-97)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2558725Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2559336Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2559337Protein automated matches [190896] (11 species)
    not a true protein
  7. 2559375Species Human (Homo sapiens) [TaxId:9606] [188315] (105 PDB entries)
  8. 2559419Domain d4fxvb1: 4fxv B:20-97 [221593]
    Other proteins in same PDB: d4fxva2, d4fxvb2, d4fxvc2, d4fxvd2
    automated match to d2cpja1

Details for d4fxvb1

PDB Entry: 4fxv (more details), 1.9 Å

PDB Description: crystal structure of an elav-like protein 1 (elavl1) from homo sapiens at 1.90 a resolution
PDB Compounds: (B:) ELAV-like protein 1

SCOPe Domain Sequences for d4fxvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fxvb1 d.58.7.0 (B:20-97) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdaerain
tlnglrlqsktikvsyar

SCOPe Domain Coordinates for d4fxvb1:

Click to download the PDB-style file with coordinates for d4fxvb1.
(The format of our PDB-style files is described here.)

Timeline for d4fxvb1: