SCOPe 2.04: Domain d4fwla2: 4fwl A:193-397

Lineage for d4fwla2 (4fwl A:193-397)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (42 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:99287] [225103] (3 PDB entries)

8. Domain d4fwla2: 4fwl A:193-397 [221574]
   automated match to d1g99a2
   complexed with edo, po4

Details for d4fwla2

PDB Entry: 4fwl, 2.4 Å

PDB Description: crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with phosphate (po4)

PDB Compounds: (A:) Propionate kinase

SCOPe Domain Sequences for d4fwla2:

Sequence; same for both SEQRES and ATOM records:

>d4fwla2 c.55.1.0 (A:193-397) automated matches {Salmonella typhimurium [TaxId: 99287]}
dekdsglivahlgngasicavrngqsvdtsmgmtpleglmmgtrsgdvdfgamawiaket
gqtlsdlervvnkesgllgisglssdlrvlekawhegherarlaiktfvhriarhiagha
aslhrldgiiftggigensvlirqlviehlgvlgltldvemnkqpnshgeriisanpsqv
icaviptneekmialdaihlgnvka

Timeline for d4fwla2:

• d4fwla2 first appeared in SCOPe 2.03
  
• d4fwla2 appears in SCOPe 2.05
  
• d4fwla2 appears in the current release, SCOPe 2.08