Lineage for d4fwla2 (4fwl A:193-397)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858517Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1858518Protein automated matches [226839] (49 species)
    not a true protein
  7. 1858926Species Salmonella typhimurium [TaxId:99287] [225103] (3 PDB entries)
  8. 1858932Domain d4fwla2: 4fwl A:193-397 [221574]
    automated match to d1g99a2
    complexed with edo, po4

Details for d4fwla2

PDB Entry: 4fwl (more details), 2.4 Å

PDB Description: crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with phosphate (po4)
PDB Compounds: (A:) Propionate kinase

SCOPe Domain Sequences for d4fwla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fwla2 c.55.1.0 (A:193-397) automated matches {Salmonella typhimurium [TaxId: 99287]}
dekdsglivahlgngasicavrngqsvdtsmgmtpleglmmgtrsgdvdfgamawiaket
gqtlsdlervvnkesgllgisglssdlrvlekawhegherarlaiktfvhriarhiagha
aslhrldgiiftggigensvlirqlviehlgvlgltldvemnkqpnshgeriisanpsqv
icaviptneekmialdaihlgnvka

SCOPe Domain Coordinates for d4fwla2:

Click to download the PDB-style file with coordinates for d4fwla2.
(The format of our PDB-style files is described here.)

Timeline for d4fwla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fwla1