| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (35 species) not a true protein |
| Species Salmonella typhimurium [TaxId:99287] [225103] (3 PDB entries) |
| Domain d4fwla2: 4fwl A:193-397 [221574] automated match to d1g99a2 complexed with edo, po4 |
PDB Entry: 4fwl (more details), 2.4 Å
SCOPe Domain Sequences for d4fwla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fwla2 c.55.1.0 (A:193-397) automated matches {Salmonella typhimurium [TaxId: 99287]}
dekdsglivahlgngasicavrngqsvdtsmgmtpleglmmgtrsgdvdfgamawiaket
gqtlsdlervvnkesgllgisglssdlrvlekawhegherarlaiktfvhriarhiagha
aslhrldgiiftggigensvlirqlviehlgvlgltldvemnkqpnshgeriisanpsqv
icaviptneekmialdaihlgnvka
Timeline for d4fwla2: