Lineage for d4foaa1 (4foa A:1-260)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578667Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2578668Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2578669Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2579104Protein automated matches [190469] (17 species)
    not a true protein
  7. 2579258Species Mycobacterium tuberculosis [TaxId:1773] [189990] (2 PDB entries)
  8. 2579259Domain d4foaa1: 4foa A:1-260 [221388]
    Other proteins in same PDB: d4foaa2
    automated match to d3qj7d_
    complexed with ufp

Details for d4foaa1

PDB Entry: 4foa (more details), 2.25 Å

PDB Description: crystal structure of the mtb thya in complex with 5-fluoro-dump
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d4foaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4foaa1 d.117.1.1 (A:1-260) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mtpyedllrfvletgtpksdrtgtgtrslfgqqmrydlsagfpllttkkvhfksvayell
wflrgdsnigwlhehgvtiwdewasdtgelgpiygvqwrswpapsgehidqisaaldllr
tdpdsrriivsawnvgeiermalppchaffqfyvadgrlscqlyqrsadlflgvpfnias
yallthmmaaqaglsvgefiwtggdchiydnhveqvrlqlsreprpypkllladrdsife
ytyedivvknydphpaikap

SCOPe Domain Coordinates for d4foaa1:

Click to download the PDB-style file with coordinates for d4foaa1.
(The format of our PDB-style files is described here.)

Timeline for d4foaa1: