SCOPe 2.08: Domain d4foaa1: 4foa A:1-260

Lineage for d4foaa1 (4foa A:1-260)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein automated matches [190469] (17 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [189990] (2 PDB entries)

8. Domain d4foaa1: 4foa A:1-260 [221388]
   Other proteins in same PDB: d4foaa2
   automated match to d3qj7d_
   complexed with ufp

Details for d4foaa1

PDB Entry: 4foa, 2.25 Å

PDB Description: crystal structure of the mtb thya in complex with 5-fluoro-dump

PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d4foaa1:

Sequence; same for both SEQRES and ATOM records:

>d4foaa1 d.117.1.1 (A:1-260) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mtpyedllrfvletgtpksdrtgtgtrslfgqqmrydlsagfpllttkkvhfksvayell
wflrgdsnigwlhehgvtiwdewasdtgelgpiygvqwrswpapsgehidqisaaldllr
tdpdsrriivsawnvgeiermalppchaffqfyvadgrlscqlyqrsadlflgvpfnias
yallthmmaaqaglsvgefiwtggdchiydnhveqvrlqlsreprpypkllladrdsife
ytyedivvknydphpaikap

Timeline for d4foaa1:

• d4foaa1 first appeared in SCOPe 2.03, called d4foaa_
  
• d4foaa1 appears in SCOPe 2.07