| Class b: All beta proteins [48724] (176 folds) |
| Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
| Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins) forms homo and heteroheptameric ring structures |
| Protein D1 core SNRNP protein [50184] (2 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [224861] (1 PDB entry) |
| Domain d4f7uc_: 4f7u C: [221064] Other proteins in same PDB: d4f7ub_, d4f7ud_, d4f7uf_, d4f7ug_, d4f7ui_, d4f7uj_ automated match to d1b34a_ complexed with p6g |
PDB Entry: 4f7u (more details), 1.9 Å
SCOPe Domain Sequences for d4f7uc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f7uc_ b.38.1.1 (C:) D1 core SNRNP protein {Mouse (Mus musculus) [TaxId: 10090]}
klvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsir
gnniryfilpdslpldtllvd
Timeline for d4f7uc_: