Lineage for d4f7uc_ (4f7u C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1786638Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1786639Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1786640Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 1786818Protein D1 core SNRNP protein [50184] (2 species)
  7. 1786842Species Mouse (Mus musculus) [TaxId:10090] [224861] (1 PDB entry)
  8. 1786844Domain d4f7uc_: 4f7u C: [221064]
    Other proteins in same PDB: d4f7ub_, d4f7ud_, d4f7uf_, d4f7ug_, d4f7ui_, d4f7uj_
    automated match to d1b34a_
    complexed with p6g

Details for d4f7uc_

PDB Entry: 4f7u (more details), 1.9 Å

PDB Description: the 6s snrnp assembly intermediate
PDB Compounds: (C:) Small nuclear ribonucleoprotein Sm D1

SCOPe Domain Sequences for d4f7uc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f7uc_ b.38.1.1 (C:) D1 core SNRNP protein {Mouse (Mus musculus) [TaxId: 10090]}
klvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsir
gnniryfilpdslpldtllvd

SCOPe Domain Coordinates for d4f7uc_:

Click to download the PDB-style file with coordinates for d4f7uc_.
(The format of our PDB-style files is described here.)

Timeline for d4f7uc_: