Lineage for d4f3pb1 (4f3p B:26-244)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624948Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1624949Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1626115Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1626116Protein automated matches [190039] (87 species)
    not a true protein
  7. 1626179Species Burkholderia pseudomallei [TaxId:320372] [226389] (1 PDB entry)
  8. 1626181Domain d4f3pb1: 4f3p B:26-244 [221013]
    automated match to d3h7ma_

Details for d4f3pb1

PDB Entry: 4f3p (more details), 2.4 Å

PDB Description: crystal structure of a glutamine-binding periplasmic protein from burkholderia pseudomallei in complex with glutamine
PDB Compounds: (B:) Glutamine-binding periplasmic protein

SCOPe Domain Sequences for d4f3pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f3pb1 c.94.1.0 (B:26-244) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
kelvvgtdtsfmpfefkqgdkyvgfdldlwaeiakgagwtykiqpmdfaglipalqtqni
dvalsgmtikeerrkaidfsdpyydsglaamvqannttiksiddlngkviaaktgtatid
wikahlkpkeirqfpnidqaylaleagrvdaamhdtpnvlffvnnegkgrvkvagapvsg
dkygigfpkgsplvakvnaelarmkadgryakiykkwfg

SCOPe Domain Coordinates for d4f3pb1:

Click to download the PDB-style file with coordinates for d4f3pb1.
(The format of our PDB-style files is described here.)

Timeline for d4f3pb1: