SCOPe 2.05: Domain d4f3pb1: 4f3p B:26-244

Lineage for d4f3pb1 (4f3p B:26-244)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (120 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:320372] [226389] (1 PDB entry)

8. Domain d4f3pb1: 4f3p B:26-244 [221013]
   automated match to d3h7ma_

Details for d4f3pb1

PDB Entry: 4f3p, 2.4 Å

PDB Description: crystal structure of a glutamine-binding periplasmic protein from burkholderia pseudomallei in complex with glutamine

PDB Compounds: (B:) Glutamine-binding periplasmic protein

SCOPe Domain Sequences for d4f3pb1:

Sequence; same for both SEQRES and ATOM records:

>d4f3pb1 c.94.1.0 (B:26-244) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
kelvvgtdtsfmpfefkqgdkyvgfdldlwaeiakgagwtykiqpmdfaglipalqtqni
dvalsgmtikeerrkaidfsdpyydsglaamvqannttiksiddlngkviaaktgtatid
wikahlkpkeirqfpnidqaylaleagrvdaamhdtpnvlffvnnegkgrvkvagapvsg
dkygigfpkgsplvakvnaelarmkadgryakiykkwfg

Timeline for d4f3pb1:

• d4f3pb1 first appeared in SCOPe 2.03
  
• d4f3pb1 appears in SCOPe 2.04
  
• d4f3pb1 appears in SCOPe 2.06
  
• d4f3pb1 appears in the current release, SCOPe 2.08