Lineage for d4f15f2 (4f15 F:111-213)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2363630Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
  8. 2364653Domain d4f15f2: 4f15 F:111-213 [220940]
    Other proteins in same PDB: d4f15c1, d4f15f1, d4f15i1, d4f15l1
    automated match to d1dqdl2

Details for d4f15f2

PDB Entry: 4f15 (more details), 2.81 Å

PDB Description: molecular basis of infectivity of 2009 pandemic h1n1 influenza a viruses
PDB Compounds: (F:) Fab fragment, light chain

SCOPe Domain Sequences for d4f15f2:

Sequence, based on SEQRES records: (download)

>d4f15f2 b.1.1.2 (F:111-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfn

Sequence, based on observed residues (ATOM records): (download)

>d4f15f2 b.1.1.2 (F:111-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsgasvvcflnnfypkinvkwkidgserqngvlnswtdqdsk
dstysmsstltlyerhnsytceathktstspivksfn

SCOPe Domain Coordinates for d4f15f2:

Click to download the PDB-style file with coordinates for d4f15f2.
(The format of our PDB-style files is described here.)

Timeline for d4f15f2: