SCOPe 2.08: Domain d4f15f2: 4f15 F:111-213

Lineage for d4f15f2 (4f15 F:111-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4f15f2: 4f15 F:111-213 [220940]
   Other proteins in same PDB: d4f15b_, d4f15c1, d4f15e_, d4f15f1, d4f15h_, d4f15i1, d4f15k_, d4f15l1
   automated match to d1dqdl2

Details for d4f15f2

PDB Entry: 4f15, 2.81 Å

PDB Description: molecular basis of infectivity of 2009 pandemic h1n1 influenza a viruses

PDB Compounds: (F:) Fab fragment, light chain

SCOPe Domain Sequences for d4f15f2:

Sequence, based on SEQRES records:

>d4f15f2 b.1.1.2 (F:111-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfn

Sequence, based on observed residues (ATOM records):

>d4f15f2 b.1.1.2 (F:111-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsgasvvcflnnfypkinvkwkidgserqngvlnswtdqdsk
dstysmsstltlyerhnsytceathktstspivksfn

Timeline for d4f15f2:

• d4f15f2 first appeared in SCOPe 2.03
  
• d4f15f2 appears in SCOPe 2.07