SCOP 1.63: Domain d1bqub2: 1bqu B:100-215

Lineage for d1bqub2 (1bqu B:100-215)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (18 proteins)

6. Protein Cytokyne receptor gp130 cytokine-binding domains [49295] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49296] (3 PDB entries)

8. Domain d1bqub2: 1bqu B:100-215 [22069]
   complexed with gol, so4

Details for d1bqub2

PDB Entry: 1bqu, 2 Å

PDB Description: cytokyne-binding region of gp130

SCOP Domain Sequences for d1bqub2:

Sequence; same for both SEQRES and ATOM records:

>d1bqub2 b.1.2.1 (B:100-215) Cytokyne receptor gp130 cytokine-binding domains {Human (Homo sapiens)}
ykvkpnpphnlsvinseelssilkltwtnpsiksviilkyniqyrtkdastwsqippedt
astrssftvqdlkpfteyvfrircmkedgkgywsdwseeasgityedrpskepsfw

Timeline for d1bqub2:

• d1bqub2 first appeared (with stable ids) in SCOP 1.55
  
• d1bqub2 appears in SCOP 1.61
  
• d1bqub2 appears in SCOP 1.65
  
• d1bqub2 appears in the current release, SCOPe 2.08