Lineage for d1bqub2 (1bqu B:100-215)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 9780Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 9781Family b.1.2.1: Fibronectin type III [49266] (14 proteins)
  6. 9786Protein Cytokyne receptor gp130 cytokine-binding domains [49295] (1 species)
  7. 9787Species Human (Homo sapiens) [TaxId:9606] [49296] (2 PDB entries)
  8. 9791Domain d1bqub2: 1bqu B:100-215 [22069]

Details for d1bqub2

PDB Entry: 1bqu (more details), 2 Å

PDB Description: cytokyne-binding region of gp130

SCOP Domain Sequences for d1bqub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqub2 b.1.2.1 (B:100-215) Cytokyne receptor gp130 cytokine-binding domains {Human (Homo sapiens)}
ykvkpnpphnlsvinseelssilkltwtnpsiksviilkyniqyrtkdastwsqippedt
astrssftvqdlkpfteyvfrircmkedgkgywsdwseeasgityedrpskepsfw

SCOP Domain Coordinates for d1bqub2:

Click to download the PDB-style file with coordinates for d1bqub2.
(The format of our PDB-style files is described here.)

Timeline for d1bqub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bqub1