Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
Superfamily c.80.1: SIS domain [53697] (4 families) |
Family c.80.1.0: automated matches [191405] (1 protein) not a true family |
Protein automated matches [190547] (18 species) not a true protein |
Species Brucella melitensis [TaxId:224914] [226367] (1 PDB entry) |
Domain d4em6b_: 4em6 B: [220643] automated match to d1t10a_ complexed with ca, cl, edo |
PDB Entry: 4em6 (more details), 1.9 Å
SCOPe Domain Sequences for d4em6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4em6b_ c.80.1.0 (B:) automated matches {Brucella melitensis [TaxId: 224914]} rdatkleatvaklkkhwaesaprdmraafsadpgrfgryslclddllfdwskcrvndetm allkelavaadvegrraamfagehinntedravlhvalrdtsskevlvdghnvlpdvkhv ldrmaafadgirsgalkgatgrkitdivnigiggsdlgpvmatlalapyhdeprahfvsn idgahiadtlspldpastliivasktfttietmtnaqtarkwvadtlgeaavgahfaavs taldkvaafgipedrvfgfwdwvggrysvwsaiglpvmiavgpdnfrkflagahamdvhf rdapleknlpvmlgligywhraicgygsraiipydqrlsrlpaylqqldmesngksvtld gkpvsgptgpvvwgepgtngqhaffqllhqgtdtiplefivaakgheptldhqhemlman claqsealmkgrtldearaqlqaknlpasqveriaphrvfsgnrpsltlihdmldpytlg rlialyehrvfveaqifginafdqwgvelgkelatellpvvsgkegasgrdastqglvah lharrk
Timeline for d4em6b_: