Lineage for d4em6c_ (4em6 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140444Family c.80.1.0: automated matches [191405] (1 protein)
    not a true family
  6. 2140445Protein automated matches [190547] (14 species)
    not a true protein
  7. 2140446Species Brucella melitensis [TaxId:224914] [226367] (1 PDB entry)
  8. 2140449Domain d4em6c_: 4em6 C: [220644]
    automated match to d1t10a_
    complexed with ca, cl, edo

Details for d4em6c_

PDB Entry: 4em6 (more details), 1.9 Å

PDB Description: The structure of Glucose-6-phosphate isomerase (GPI) from Brucella melitensis
PDB Compounds: (C:) Glucose-6-phosphate isomerase

SCOPe Domain Sequences for d4em6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4em6c_ c.80.1.0 (C:) automated matches {Brucella melitensis [TaxId: 224914]}
atkleatvaklkkhwaesaprdmraafsadpgrfgryslclddllfdwskcrvndetmal
lkelavaadvegrraamfagehinntedravlhvalrdtsskevlvdghnvlpdvkhvld
rmaafadgirsgalkgatgrkitdivnigiggsdlgpvmatlalapyhdeprahfvsnid
gahiadtlspldpastliivasktfttietmtnaqtarkwvadtlgeaavgahfaavsta
ldkvaafgipedrvfgfwdwvggrysvwsaiglpvmiavgpdnfrkflagahamdvhfrd
apleknlpvmlgligywhraicgygsraiipydqrlsrlpaylqqldmesngksvtldgk
pvsgptgpvvwgepgtngqhaffqllhqgtdtiplefivaakgheptldhqhemlmancl
aqsealmkgrtldearaqlqaknlpasqveriaphrvfsgnrpsltlihdmldpytlgrl
ialyehrvfveaqifginafdqwgvelgkelatellpvvsgkegasgrdastqglvahlh
arrk

SCOPe Domain Coordinates for d4em6c_:

Click to download the PDB-style file with coordinates for d4em6c_.
(The format of our PDB-style files is described here.)

Timeline for d4em6c_: