PDB entry 4em6

View 4em6 on RCSB PDB site
Description: The structure of Glucose-6-phosphate isomerase (GPI) from Brucella melitensis
Class: isomerase
Keywords: Glucose-6-phosphate isomerase, GPI, Phosphoglucose isomerase, PGI, Phosphohexose isomerase, PHI, SSGCID, Seattle Structural Genomics Center for Infectious Disease, NIAID, National Institute of Allergy and Infectious Diseases, isomerase
Deposited on 2012-04-11, released 2012-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.133
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-6-phosphate isomerase
    Species: Brucella melitensis bv. 1 [TaxId:224914]
    Gene: pgi, BMEI1636
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4em6a_
  • Chain 'B':
    Compound: Glucose-6-phosphate isomerase
    Species: Brucella melitensis bv. 1 [TaxId:224914]
    Gene: pgi, BMEI1636
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4em6b_
  • Chain 'C':
    Compound: Glucose-6-phosphate isomerase
    Species: Brucella melitensis bv. 1 [TaxId:224914]
    Gene: pgi, BMEI1636
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4em6c_
  • Chain 'D':
    Compound: Glucose-6-phosphate isomerase
    Species: Brucella melitensis bv. 1 [TaxId:224914]
    Gene: pgi, BMEI1636
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4em6d_
  • Heterogens: CL, CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4em6A (A:)
    gpgsmardatkleatvaklkkhwaesaprdmraafsadpgrfgryslclddllfdwskcr
    vndetmallkelavaadvegrraamfagehinntedravlhvalrdtsskevlvdghnvl
    pdvkhvldrmaafadgirsgalkgatgrkitdivnigiggsdlgpvmatlalapyhdepr
    ahfvsnidgahiadtlspldpastliivasktfttietmtnaqtarkwvadtlgeaavga
    hfaavstaldkvaafgipedrvfgfwdwvggrysvwsaiglpvmiavgpdnfrkflagah
    amdvhfrdapleknlpvmlgligywhraicgygsraiipydqrlsrlpaylqqldmesng
    ksvtldgkpvsgptgpvvwgepgtngqhaffqllhqgtdtiplefivaakgheptldhqh
    emlmanclaqsealmkgrtldearaqlqaknlpasqveriaphrvfsgnrpsltlihdml
    dpytlgrlialyehrvfveaqifginafdqwgvelgkelatellpvvsgkegasgrdast
    qglvahlharrka
    

    Sequence, based on observed residues (ATOM records): (download)
    >4em6A (A:)
    rdatkleatvaklkkhwaesaprdmraafsadpgrfgryslclddllfdwskcrvndetm
    allkelavaadvegrraamfagehinntedravlhvalrdtsskevlvdghnvlpdvkhv
    ldrmaafadgirsgalkgatgrkitdivnigiggsdlgpvmatlalapyhdeprahfvsn
    idgahiadtlspldpastliivasktfttietmtnaqtarkwvadtlgeaavgahfaavs
    taldkvaafgipedrvfgfwdwvggrysvwsaiglpvmiavgpdnfrkflagahamdvhf
    rdapleknlpvmlgligywhraicgygsraiipydqrlsrlpaylqqldmesngksvtld
    gkpvsgptgpvvwgepgtngqhaffqllhqgtdtiplefivaakgheptldhqhemlman
    claqsealmkgrtldearaqlqaknlpasqveriaphrvfsgnrpsltlihdmldpytlg
    rlialyehrvfveaqifginafdqwgvelgkelatellpvvsgkegasgrdastqglvah
    lharrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4em6B (B:)
    gpgsmardatkleatvaklkkhwaesaprdmraafsadpgrfgryslclddllfdwskcr
    vndetmallkelavaadvegrraamfagehinntedravlhvalrdtsskevlvdghnvl
    pdvkhvldrmaafadgirsgalkgatgrkitdivnigiggsdlgpvmatlalapyhdepr
    ahfvsnidgahiadtlspldpastliivasktfttietmtnaqtarkwvadtlgeaavga
    hfaavstaldkvaafgipedrvfgfwdwvggrysvwsaiglpvmiavgpdnfrkflagah
    amdvhfrdapleknlpvmlgligywhraicgygsraiipydqrlsrlpaylqqldmesng
    ksvtldgkpvsgptgpvvwgepgtngqhaffqllhqgtdtiplefivaakgheptldhqh
    emlmanclaqsealmkgrtldearaqlqaknlpasqveriaphrvfsgnrpsltlihdml
    dpytlgrlialyehrvfveaqifginafdqwgvelgkelatellpvvsgkegasgrdast
    qglvahlharrka
    

    Sequence, based on observed residues (ATOM records): (download)
    >4em6B (B:)
    rdatkleatvaklkkhwaesaprdmraafsadpgrfgryslclddllfdwskcrvndetm
    allkelavaadvegrraamfagehinntedravlhvalrdtsskevlvdghnvlpdvkhv
    ldrmaafadgirsgalkgatgrkitdivnigiggsdlgpvmatlalapyhdeprahfvsn
    idgahiadtlspldpastliivasktfttietmtnaqtarkwvadtlgeaavgahfaavs
    taldkvaafgipedrvfgfwdwvggrysvwsaiglpvmiavgpdnfrkflagahamdvhf
    rdapleknlpvmlgligywhraicgygsraiipydqrlsrlpaylqqldmesngksvtld
    gkpvsgptgpvvwgepgtngqhaffqllhqgtdtiplefivaakgheptldhqhemlman
    claqsealmkgrtldearaqlqaknlpasqveriaphrvfsgnrpsltlihdmldpytlg
    rlialyehrvfveaqifginafdqwgvelgkelatellpvvsgkegasgrdastqglvah
    lharrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4em6C (C:)
    gpgsmardatkleatvaklkkhwaesaprdmraafsadpgrfgryslclddllfdwskcr
    vndetmallkelavaadvegrraamfagehinntedravlhvalrdtsskevlvdghnvl
    pdvkhvldrmaafadgirsgalkgatgrkitdivnigiggsdlgpvmatlalapyhdepr
    ahfvsnidgahiadtlspldpastliivasktfttietmtnaqtarkwvadtlgeaavga
    hfaavstaldkvaafgipedrvfgfwdwvggrysvwsaiglpvmiavgpdnfrkflagah
    amdvhfrdapleknlpvmlgligywhraicgygsraiipydqrlsrlpaylqqldmesng
    ksvtldgkpvsgptgpvvwgepgtngqhaffqllhqgtdtiplefivaakgheptldhqh
    emlmanclaqsealmkgrtldearaqlqaknlpasqveriaphrvfsgnrpsltlihdml
    dpytlgrlialyehrvfveaqifginafdqwgvelgkelatellpvvsgkegasgrdast
    qglvahlharrka
    

    Sequence, based on observed residues (ATOM records): (download)
    >4em6C (C:)
    atkleatvaklkkhwaesaprdmraafsadpgrfgryslclddllfdwskcrvndetmal
    lkelavaadvegrraamfagehinntedravlhvalrdtsskevlvdghnvlpdvkhvld
    rmaafadgirsgalkgatgrkitdivnigiggsdlgpvmatlalapyhdeprahfvsnid
    gahiadtlspldpastliivasktfttietmtnaqtarkwvadtlgeaavgahfaavsta
    ldkvaafgipedrvfgfwdwvggrysvwsaiglpvmiavgpdnfrkflagahamdvhfrd
    apleknlpvmlgligywhraicgygsraiipydqrlsrlpaylqqldmesngksvtldgk
    pvsgptgpvvwgepgtngqhaffqllhqgtdtiplefivaakgheptldhqhemlmancl
    aqsealmkgrtldearaqlqaknlpasqveriaphrvfsgnrpsltlihdmldpytlgrl
    ialyehrvfveaqifginafdqwgvelgkelatellpvvsgkegasgrdastqglvahlh
    arrk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4em6D (D:)
    gpgsmardatkleatvaklkkhwaesaprdmraafsadpgrfgryslclddllfdwskcr
    vndetmallkelavaadvegrraamfagehinntedravlhvalrdtsskevlvdghnvl
    pdvkhvldrmaafadgirsgalkgatgrkitdivnigiggsdlgpvmatlalapyhdepr
    ahfvsnidgahiadtlspldpastliivasktfttietmtnaqtarkwvadtlgeaavga
    hfaavstaldkvaafgipedrvfgfwdwvggrysvwsaiglpvmiavgpdnfrkflagah
    amdvhfrdapleknlpvmlgligywhraicgygsraiipydqrlsrlpaylqqldmesng
    ksvtldgkpvsgptgpvvwgepgtngqhaffqllhqgtdtiplefivaakgheptldhqh
    emlmanclaqsealmkgrtldearaqlqaknlpasqveriaphrvfsgnrpsltlihdml
    dpytlgrlialyehrvfveaqifginafdqwgvelgkelatellpvvsgkegasgrdast
    qglvahlharrka
    

    Sequence, based on observed residues (ATOM records): (download)
    >4em6D (D:)
    rdatkleatvaklkkhwaesaprdmraafsadpgrfgryslclddllfdwskcrvndetm
    allkelavaadvegrraamfagehinntedravlhvalrdtsskevlvdghnvlpdvkhv
    ldrmaafadgirsgalkgatgrkitdivnigiggsdlgpvmatlalapyhdeprahfvsn
    idgahiadtlspldpastliivasktfttietmtnaqtarkwvadtlgeaavgahfaavs
    taldkvaafgipedrvfgfwdwvggrysvwsaiglpvmiavgpdnfrkflagahamdvhf
    rdapleknlpvmlgligywhraicgygsraiipydqrlsrlpaylqqldmesngksvtld
    gkpvsgptgpvvwgepgtngqhaffqllhqgtdtiplefivaakgheptldhqhemlman
    claqsealmkgrtldearaqlqaknlpasqveriaphrvfsgnrpsltlihdmldpytlg
    rlialyehrvfveaqifginafdqwgvelgkelatellpvvsgkegasgrdastqglvah
    lharrk