| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein Granulocyte colony-stimulating factor (GC-SF) receptor [49291] (2 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [49292] (4 PDB entries) |
| Domain d1gcfa_: 1gcf A: [22053] 2nd domain |
PDB Entry: 1gcf (more details)
SCOPe Domain Sequences for d1gcfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gcfa_ b.1.2.1 (A:) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]}
gssleppmlqaldigpdvvshqpgclwlswkpwkpseymeqecelryqpqlkganwtlvf
hlpsskdqfelcglhqapvytlqmrcirsslpgfwspwspglqlrptmk
Timeline for d1gcfa_: