PDB entry 1gcf

View 1gcf on RCSB PDB site
Description: nmr structure of the c-terminal domain of the ligand-binding region of murine granulocyte colony-stimulating factor receptor, 12 structures
Class: binding protein
Keywords: binding protein, cytokine receptor
Deposited on 1997-04-10, released 1997-10-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: granulocyte colony-stimulating factor receptor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1gcfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gcfA (A:)
    gssleppmlqaldigpdvvshqpgclwlswkpwkpseymeqecelryqpqlkganwtlvf
    hlpsskdqfelcglhqapvytlqmrcirsslpgfwspwspglqlrptmk