Lineage for d1gcf__ (1gcf -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 9780Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 9781Family b.1.2.1: Fibronectin type III [49266] (14 proteins)
  6. 9856Protein Granulocyte colony-stimulating factor (GC-SF) receptor [49291] (1 species)
  7. 9857Species Mouse (Mus musculus) [TaxId:10090] [49292] (4 PDB entries)
  8. 9870Domain d1gcf__: 1gcf - [22053]

Details for d1gcf__

PDB Entry: 1gcf (more details)

PDB Description: nmr structure of the c-terminal domain of the ligand-binding region of murine granulocyte colony-stimulating factor receptor, 12 structures

SCOP Domain Sequences for d1gcf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gcf__ b.1.2.1 (-) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus)}
gssleppmlqaldigpdvvshqpgclwlswkpwkpseymeqecelryqpqlkganwtlvf
hlpsskdqfelcglhqapvytlqmrcirsslpgfwspwspglqlrptmk

SCOP Domain Coordinates for d1gcf__:

Click to download the PDB-style file with coordinates for d1gcf__.
(The format of our PDB-style files is described here.)

Timeline for d1gcf__: