Lineage for d4efha2 (4efh A:147-374)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605037Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1605420Protein automated matches [226905] (11 species)
    not a true protein
  7. 1605421Species Acanthamoeba castellanii [TaxId:5755] [226350] (1 PDB entry)
  8. 1605422Domain d4efha2: 4efh A:147-374 [220465]
    Other proteins in same PDB: d4efha1
    automated match to d1c0fa2
    complexed with adp, ca

Details for d4efha2

PDB Entry: 4efh (more details), 2.48 Å

PDB Description: Acanthamoeba Actin complex with Spir domain D
PDB Compounds: (A:) Actin-1

SCOPe Domain Sequences for d4efha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4efha2 c.55.1.1 (A:147-374) automated matches {Acanthamoeba castellanii [TaxId: 5755]}
rttgivldsgdgvthtvpiyegyalphailrldlagrdltdylmkiltergysftttaer
eivrdikeklcyvaldfeqemhtaasssaleksyelpdgqvitignerfrapealfqpsf
lgmesagihettynsimkcdvdirkdlygnvvlsggttmfpgiadrmqkeltalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskeeydesgpsivhrkc

SCOPe Domain Coordinates for d4efha2:

Click to download the PDB-style file with coordinates for d4efha2.
(The format of our PDB-style files is described here.)

Timeline for d4efha2: