![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
![]() | Protein automated matches [226905] (10 species) not a true protein |
![]() | Species Acanthamoeba castellanii [TaxId:5755] [226350] (1 PDB entry) |
![]() | Domain d4efha2: 4efh A:147-374 [220465] Other proteins in same PDB: d4efha1 automated match to d1c0fa2 complexed with adp, ca |
PDB Entry: 4efh (more details), 2.48 Å
SCOPe Domain Sequences for d4efha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4efha2 c.55.1.1 (A:147-374) automated matches {Acanthamoeba castellanii [TaxId: 5755]} rttgivldsgdgvthtvpiyegyalphailrldlagrdltdylmkiltergysftttaer eivrdikeklcyvaldfeqemhtaasssaleksyelpdgqvitignerfrapealfqpsf lgmesagihettynsimkcdvdirkdlygnvvlsggttmfpgiadrmqkeltalapstmk ikiiapperkysvwiggsilaslstfqqmwiskeeydesgpsivhrkc
Timeline for d4efha2: