Lineage for d4efha1 (4efh A:5-146)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1373353Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1373354Protein automated matches [226839] (35 species)
    not a true protein
  7. 1373355Species Acanthamoeba castellanii [TaxId:5755] [226349] (1 PDB entry)
  8. 1373356Domain d4efha1: 4efh A:5-146 [220464]
    Other proteins in same PDB: d4efha2
    automated match to d1c0fa1
    complexed with adp, ca

Details for d4efha1

PDB Entry: 4efh (more details), 2.48 Å

PDB Description: Acanthamoeba Actin complex with Spir domain D
PDB Compounds: (A:) Actin-1

SCOPe Domain Sequences for d4efha1:

Sequence, based on SEQRES records: (download)

>d4efha1 c.55.1.0 (A:5-146) automated matches {Acanthamoeba castellanii [TaxId: 5755]}
vqalvidngsgmckagfagddapravfpsivgrprhtgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimf
etfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d4efha1 c.55.1.0 (A:5-146) automated matches {Acanthamoeba castellanii [TaxId: 5755]}
vqalvidngsgmckagfagddapravfpsivgrprhtgqkdsyvgdeaqskrgiltlkyp
iehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntp
amyvaiqavlslyasg

SCOPe Domain Coordinates for d4efha1:

Click to download the PDB-style file with coordinates for d4efha1.
(The format of our PDB-style files is described here.)

Timeline for d4efha1: