Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Acanthamoeba castellanii [TaxId:5755] [226349] (1 PDB entry) |
Domain d4efha1: 4efh A:5-146 [220464] Other proteins in same PDB: d4efha2 automated match to d1c0fa1 complexed with adp, ca |
PDB Entry: 4efh (more details), 2.48 Å
SCOPe Domain Sequences for d4efha1:
Sequence, based on SEQRES records: (download)
>d4efha1 c.55.1.0 (A:5-146) automated matches {Acanthamoeba castellanii [TaxId: 5755]} vqalvidngsgmckagfagddapravfpsivgrprhtgvmvgmgqkdsyvgdeaqskrgi ltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimf etfntpamyvaiqavlslyasg
>d4efha1 c.55.1.0 (A:5-146) automated matches {Acanthamoeba castellanii [TaxId: 5755]} vqalvidngsgmckagfagddapravfpsivgrprhtgqkdsyvgdeaqskrgiltlkyp iehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntp amyvaiqavlslyasg
Timeline for d4efha1: