Lineage for d4e2fh2 (4e2f H:101-153)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036845Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) (S)
    automatically mapped to Pfam PF02748
  5. 3036846Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 3036847Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)
  7. 3036848Species Escherichia coli [TaxId:562] [57828] (62 PDB entries)
    Uniprot P00478
  8. 3036908Domain d4e2fh2: 4e2f H:101-153 [220184]
    Other proteins in same PDB: d4e2fa1, d4e2fa2, d4e2fb1, d4e2fc1, d4e2fc2, d4e2fd1, d4e2fe1, d4e2fe2, d4e2ff1, d4e2fg1, d4e2fg2, d4e2fh1, d4e2fi1, d4e2fi2, d4e2fj1, d4e2fk1, d4e2fk2, d4e2fl1
    automated match to d1d09b2
    complexed with zn; mutant

Details for d4e2fh2

PDB Entry: 4e2f (more details), 2.8 Å

PDB Description: Crystal Structure of E. coli Aspartate Transcarbamoylase K164E/E239K Mutant in an intermediate state
PDB Compounds: (H:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d4e2fh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e2fh2 g.41.7.1 (H:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOPe Domain Coordinates for d4e2fh2:

Click to download the PDB-style file with coordinates for d4e2fh2.
(The format of our PDB-style files is described here.)

Timeline for d4e2fh2: