| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
| Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) |
| Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species) |
| Species Escherichia coli [TaxId:562] [53674] (62 PDB entries) Uniprot P00479 |
| Domain d4e2fa1: 4e2f A:1-150 [220169] Other proteins in same PDB: d4e2fb1, d4e2fb2, d4e2fd1, d4e2fd2, d4e2ff1, d4e2ff2, d4e2fh1, d4e2fh2, d4e2fj1, d4e2fj2, d4e2fl1, d4e2fl2 automated match to d1ekxa1 complexed with zn; mutant |
PDB Entry: 4e2f (more details), 2.8 Å
SCOPe Domain Sequences for d4e2fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e2fa1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg
Timeline for d4e2fa1: