| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
| Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins) |
| Protein automated matches [190524] (2 species) not a true protein |
| Species French bean (Phaseolus vulgaris) [TaxId:3885] [226472] (6 PDB entries) |
| Domain d4dsyb2: 4dsy B:121-432 [220005] Other proteins in same PDB: d4dsya1, d4dsyb1, d4dsyc1, d4dsyd1 automated match to d1kbpa2 complexed with 0lo, act, edo, fe, gol, nag, so4, zn |
PDB Entry: 4dsy (more details), 2.3 Å
SCOPe Domain Sequences for d4dsyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dsyb2 d.159.1.1 (B:121-432) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
eamrtkfeawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitig
dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
fnrhwypvddst
Timeline for d4dsyb2: