Lineage for d4dsyb2 (4dsy B:121-432)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440476Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1440477Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1440478Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins)
  6. 1440508Protein automated matches [190524] (2 species)
    not a true protein
  7. 1440512Species Phaseolus vulgaris [TaxId:3885] [226472] (3 PDB entries)
  8. 1440518Domain d4dsyb2: 4dsy B:121-432 [220005]
    Other proteins in same PDB: d4dsya1, d4dsyb1, d4dsyc1, d4dsyd1
    automated match to d1kbpa2
    complexed with 0lo, act, edo, fe, gol, nag, so4, zn

Details for d4dsyb2

PDB Entry: 4dsy (more details), 2.3 Å

PDB Description: crystal structure of red kidney bean purple acid phosphatase in complex with maybridge fragment cc24201
PDB Compounds: (B:) purple acid phosphatase

SCOPe Domain Sequences for d4dsyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dsyb2 d.159.1.1 (B:121-432) automated matches {Phaseolus vulgaris [TaxId: 3885]}
qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
eamrtkfeawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitig
dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
fnrhwypvddst

SCOPe Domain Coordinates for d4dsyb2:

Click to download the PDB-style file with coordinates for d4dsyb2.
(The format of our PDB-style files is described here.)

Timeline for d4dsyb2: