| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families) ![]() |
| Family b.1.12.0: automated matches [227279] (1 protein) not a true family |
| Protein automated matches [227090] (1 species) not a true protein |
| Species Phaseolus vulgaris [TaxId:3885] [226471] (3 PDB entries) |
| Domain d4dsyd1: 4dsy D:7-120 [220008] Other proteins in same PDB: d4dsya2, d4dsyb2, d4dsyc2, d4dsyd2 automated match to d2qfra1 complexed with 0lo, act, edo, fe, gol, nag, so4, zn |
PDB Entry: 4dsy (more details), 2.3 Å
SCOPe Domain Sequences for d4dsyd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dsyd1 b.1.12.0 (D:7-120) automated matches {Phaseolus vulgaris [TaxId: 3885]}
knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp
Timeline for d4dsyd1: