SCOPe 2.05: Domain d4dsyc2: 4dsy C:121-430

Lineage for d4dsyc2 (4dsy C:121-430)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins)

6. Protein automated matches [190524] (2 species)
   not a true protein

7. Species French bean (Phaseolus vulgaris) [TaxId:3885] [226472] (6 PDB entries)

8. Domain d4dsyc2: 4dsy C:121-430 [220007]
   Other proteins in same PDB: d4dsya1, d4dsyb1, d4dsyc1, d4dsyd1
   automated match to d1kbpa2
   complexed with 0lo, act, edo, fe, gol, nag, so4, zn

Details for d4dsyc2

PDB Entry: 4dsy, 2.3 Å

PDB Description: crystal structure of red kidney bean purple acid phosphatase in complex with maybridge fragment cc24201

PDB Compounds: (C:) purple acid phosphatase

SCOPe Domain Sequences for d4dsyc2:

Sequence; same for both SEQRES and ATOM records:

>d4dsyc2 d.159.1.1 (C:121-430) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
eamrtkfeawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitig
dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
fnrhwypvdd

Timeline for d4dsyc2:

• d4dsyc2 first appeared in SCOPe 2.03
  
• d4dsyc2 appears in SCOPe 2.04
  
• d4dsyc2 appears in SCOPe 2.06
  
• d4dsyc2 appears in the current release, SCOPe 2.08