PDB entry 4dsy

View 4dsy on RCSB PDB site
Description: Crystal structure of red kidney bean purple acid phosphatase in complex with Maybridge fragment CC24201
Class: hydrolase/hydrolase inhibitor
Keywords: phosphatase, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-02-20, released 2012-09-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-01-02, with a file datestamp of 2012-12-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.164
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Gene: pap
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4dsya1, d4dsya2
  • Chain 'B':
    Compound: purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Gene: pap
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4dsyb1, d4dsyb2
  • Chain 'C':
    Compound: purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Gene: pap
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4dsyc1, d4dsyc2
  • Chain 'D':
    Compound: purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Gene: pap
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4dsyd1, d4dsyd2
  • Heterogens: ZN, FE, 0LO, GOL, NAG, SO4, EDO, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dsyA (A:)
    knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
    kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldv
    pytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrft
    ersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasah
    iivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtk
    feawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnyg
    vidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwy
    pvddst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dsyA (A:)
    knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
    kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldv
    pytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrft
    ersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasah
    iivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtk
    feawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnyg
    vidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwy
    pvdds
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dsyB (B:)
    knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
    kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldv
    pytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrft
    ersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasah
    iivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtk
    feawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnyg
    vidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwy
    pvddst
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4dsyC (C:)
    knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
    kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldv
    pytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrft
    ersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasah
    iivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtk
    feawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnyg
    vidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwy
    pvddst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dsyC (C:)
    nrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrk
    riakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvp
    ytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfte
    rsvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahi
    ivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkf
    eawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnygv
    idsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwyp
    vdd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dsyD (D:)
    knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
    kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldv
    pytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrft
    ersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasah
    iivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtk
    feawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnyg
    vidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwy
    pvddst