Lineage for d4drxa2 (4drx A:246-437)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2525526Protein automated matches [227071] (5 species)
    not a true protein
  7. 2525736Species Sheep (Ovis aries) [TaxId:9940] [226224] (19 PDB entries)
  8. 2525737Domain d4drxa2: 4drx A:246-437 [219980]
    Other proteins in same PDB: d4drxa1, d4drxb1, d4drxc1, d4drxd1, d4drxe_, d4drxf_
    automated match to d1tuba2
    complexed with gtp, mg

Details for d4drxa2

PDB Entry: 4drx (more details), 2.22 Å

PDB Description: GTP-Tubulin in complex with a DARPIN
PDB Compounds: (A:) Tubulin alpha chain

SCOPe Domain Sequences for d4drxa2:

Sequence, based on SEQRES records: (download)

>d4drxa2 d.79.2.1 (A:246-437) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

Sequence, based on observed residues (ATOM records): (download)

>d4drxa2 d.79.2.1 (A:246-437) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
galnvdltefqtnlvpyprihfplatyapvisaeqlsvaeitnacfepanqmvkcdprhg
kymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpggdlak
vqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaalek
dyeevgv

SCOPe Domain Coordinates for d4drxa2:

Click to download the PDB-style file with coordinates for d4drxa2.
(The format of our PDB-style files is described here.)

Timeline for d4drxa2: