Lineage for d4drxc1 (4drx C:2-245)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107739Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2107740Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2107741Family c.32.1.1: Tubulin, GTPase domain [52491] (4 protein domains)
  6. 2107851Protein automated matches [226837] (7 species)
    not a true protein
  7. 2107925Species Sheep (Ovis aries) [TaxId:9940] [224884] (13 PDB entries)
  8. 2107928Domain d4drxc1: 4drx C:2-245 [219983]
    Other proteins in same PDB: d4drxa2, d4drxb2, d4drxc2, d4drxd2, d4drxe_, d4drxf_
    automated match to d1tuba1
    complexed with gtp, mg

Details for d4drxc1

PDB Entry: 4drx (more details), 2.22 Å

PDB Description: GTP-Tubulin in complex with a DARPIN
PDB Compounds: (C:) Tubulin alpha chain

SCOPe Domain Sequences for d4drxc1:

Sequence, based on SEQRES records: (download)

>d4drxc1 c.32.1.1 (C:2-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
recisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagkh
vpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldr
irkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstav
vepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssitas
lrfd

Sequence, based on observed residues (ATOM records): (download)

>d4drxc1 c.32.1.1 (C:2-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
recisihvgqagvqignacwelyclehgiqpdgqmpdsfntffsetgagkhvpravfvdl
eptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrirkladqct
glqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavvepynsilt
thttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssitaslrfd

SCOPe Domain Coordinates for d4drxc1:

Click to download the PDB-style file with coordinates for d4drxc1.
(The format of our PDB-style files is described here.)

Timeline for d4drxc1: