| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
| Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
| Protein automated matches [227071] (7 species) not a true protein |
| Species Sheep (Ovis aries) [TaxId:9940] [226224] (15 PDB entries) |
| Domain d4drxd2: 4drx D:246-441 [219986] Other proteins in same PDB: d4drxa1, d4drxb1, d4drxc1, d4drxd1, d4drxe_, d4drxf_ automated match to d1z2bb2 complexed with gtp, mg |
PDB Entry: 4drx (more details), 2.22 Å
SCOPe Domain Sequences for d4drxd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4drxd2 d.79.2.1 (D:246-441) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad
Timeline for d4drxd2: