SCOPe 2.07: Domain d4dpoa1: 4dpo A:3-96

Lineage for d4dpoa1 (4dpo A:3-96)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (31 species)
   not a true protein

7. Species Methanosarcina mazei [TaxId:192952] [226315] (1 PDB entry)

8. Domain d4dpoa1: 4dpo A:3-96 [219923]
   Other proteins in same PDB: d4dpoa2, d4dpob2
   automated match to d1x7vc_

Details for d4dpoa1

PDB Entry: 4dpo, 2.73 Å

PDB Description: crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1

PDB Compounds: (A:) conserved protein

SCOPe Domain Sequences for d4dpoa1:

Sequence; same for both SEQRES and ATOM records:

>d4dpoa1 d.58.4.0 (A:3-96) automated matches {Methanosarcina mazei [TaxId: 192952]}
airvvaknqvkpekvqefmnlckslieetlkeegcidygvyqelenpeiltmleewkdeg
sldqhirsdhfkeifpllsecldketeiniyrkk

Timeline for d4dpoa1:

• d4dpoa1 first appeared in SCOPe 2.03, called d4dpoa_
  
• d4dpoa1 appears in SCOPe 2.06
  
• d4dpoa1 appears in the current release, SCOPe 2.08