Lineage for d1x7vc_ (1x7v C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906842Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 1907024Family d.58.4.11: PA3566-like [110970] (5 proteins)
    subfamily of Pfam PF03992
  6. 1907041Protein Hypothetical protein PA3566 [110971] (1 species)
  7. 1907042Species Pseudomonas aeruginosa [TaxId:287] [110972] (1 PDB entry)
    Uniprot Q9HY51
  8. 1907045Domain d1x7vc_: 1x7v C: [109503]
    Structural genomics target
    complexed with so4

Details for d1x7vc_

PDB Entry: 1x7v (more details), 1.78 Å

PDB Description: Crystal structure of PA3566 from Pseudomonas aeruginosa
PDB Compounds: (C:) PA3566 protein

SCOPe Domain Sequences for d1x7vc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x7vc_ d.58.4.11 (C:) Hypothetical protein PA3566 {Pseudomonas aeruginosa [TaxId: 287]}
ghmstpltliatitaapghaealerelralvapsraeagclqydlhqdrhdshlfymieq
wrddaalerhqntehflrfsrgneallqnvkidqlyrla

SCOPe Domain Coordinates for d1x7vc_:

Click to download the PDB-style file with coordinates for d1x7vc_.
(The format of our PDB-style files is described here.)

Timeline for d1x7vc_: