SCOPe 2.03: Domain d4dpoa_: 4dpo A:

Lineage for d4dpoa_ (4dpo A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (17 species)
   not a true protein

7. Species Methanosarcina mazei [TaxId:192952] [226315] (1 PDB entry)

8. Domain d4dpoa_: 4dpo A: [219923]
   automated match to d1x7vc_

Details for d4dpoa_

PDB Entry: 4dpo, 2.73 Å

PDB Description: crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1

PDB Compounds: (A:) conserved protein

SCOPe Domain Sequences for d4dpoa_:

Sequence; same for both SEQRES and ATOM records:

>d4dpoa_ d.58.4.0 (A:) automated matches {Methanosarcina mazei [TaxId: 192952]}
nlyfqsmlairvvaknqvkpekvqefmnlckslieetlkeegcidygvyqelenpeiltm
leewkdegsldqhirsdhfkeifpllsecldketeiniyrkk

Timeline for d4dpoa_:

• d4dpoa_ is new in SCOPe 2.03-stable
  
• d4dpoa_ appears in SCOPe 2.04
  
• d4dpoa_ appears in the current release, SCOPe 2.08, called d4dpoa1