SCOPe 2.08: Domain d1cfba1: 1cfb A:610-709

Lineage for d1cfba1 (1cfb A:610-709)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Neuroglian, two amino proximal Fn3 repeats [49276] (1 species)
   tandem of fibronectin type III domains

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [49277] (1 PDB entry)

8. Domain d1cfba1: 1cfb A:610-709 [21991]
   complexed with na, nag, so4

Details for d1cfba1

PDB Entry: 1cfb, 2 Å

PDB Description: crystal structure of tandem type iii fibronectin domains from drosophila neuroglian at 2.0 angstroms

PDB Compounds: (A:) drosophila neuroglian

SCOPe Domain Sequences for d1cfba1:

Sequence; same for both SEQRES and ATOM records:

>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ivqdvpnapkltgitcqadkaeihweqqgdnrspilhytiqfntsftpaswdaayekvpn
tdssfvvqmspwanytfrviafnkigasppsahsdscttq

Timeline for d1cfba1:

• d1cfba1 first appeared (with stable ids) in SCOP 1.55, called d1cfb_1
  
• d1cfba1 appears in SCOPe 2.07