Lineage for d1cfba2 (1cfb A:710-814)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2762090Protein Neuroglian, two amino proximal Fn3 repeats [49276] (1 species)
    tandem of fibronectin type III domains
  7. 2762091Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [49277] (1 PDB entry)
  8. 2762093Domain d1cfba2: 1cfb A:710-814 [21992]
    complexed with na, nag, so4

Details for d1cfba2

PDB Entry: 1cfb (more details), 2 Å

PDB Description: crystal structure of tandem type iii fibronectin domains from drosophila neuroglian at 2.0 angstroms
PDB Compounds: (A:) drosophila neuroglian

SCOPe Domain Sequences for d1cfba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pdvpfknpdnvvgqgtepnnlviswtpmpeiehnapnfhyyvswkrdipaaawennnifd
wrqnniviadqptfvkylikvvaindrgesnvaaeevvgysgedr

SCOPe Domain Coordinates for d1cfba2:

Click to download the PDB-style file with coordinates for d1cfba2.
(The format of our PDB-style files is described here.)

Timeline for d1cfba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cfba1