PDB entry 1cfb

View 1cfb on RCSB PDB site
Description: crystal structure of tandem type III fibronectin domains from drosophila neuroglian at 2.0 angstroms
Class: neural adhesion molecule
Keywords: neural adhesion molecule
Deposited on 1994-08-27, released 1994-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: drosophila neuroglian
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cfba1, d1cfba2
  • Heterogens: NAG, SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cfbA (A:)
    ivqdvpnapkltgitcqadkaeihweqqgdnrspilhytiqfntsftpaswdaayekvpn
    tdssfvvqmspwanytfrviafnkigasppsahsdscttqpdvpfknpdnvvgqgtepnn
    lviswtpmpeiehnapnfhyyvswkrdipaaawennnifdwrqnniviadqptfvkylik
    vvaindrgesnvaaeevvgysgedr