SCOP 1.75: Domain d2mfna1: 2mfn A:1-92

Lineage for d2mfna1 (2mfn A:1-92)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (44 proteins)
   Pfam PF00041

6. Protein Fibronectin, different Fn3 modules [49270] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49272] (2 PDB entries)

8. Domain d2mfna1: 2mfn A:1-92 [21982]

Details for d2mfna1

PDB Entry: 2mfn

PDB Description: solution nmr structure of linked cell attachment modules of mouse fibronectin containing the rgd and synergy regions, 10 structures

PDB Compounds: (A:) Fibronectin

SCOP Domain Sequences for d2mfna1:

Sequence; same for both SEQRES and ATOM records:

>d2mfna1 b.1.2.1 (A:1-92) Fibronectin, different Fn3 modules {Mouse (Mus musculus) [TaxId: 10090]}
gldsptgfdssditansftvhwvaprapitgyiirhhaehsvgrprqdrvppsrnsitlt
nlnpgteyvvsiiavngreesppligqqatvs

Timeline for d2mfna1:

• d2mfna1 first appeared (with stable ids) in SCOP 1.55, called d2mfn_1
  
• d2mfna1 appears in SCOP 1.73
  
• d2mfna1 appears in SCOPe 2.01
  
• d2mfna1 appears in the current release, SCOPe 2.08