Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) |
Family b.1.2.1: Fibronectin type III [49266] (44 proteins) Pfam PF00041 |
Protein Fibronectin, different Fn3 modules [49270] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [49272] (2 PDB entries) |
Domain d2mfna1: 2mfn A:1-92 [21982] |
PDB Entry: 2mfn (more details)
SCOP Domain Sequences for d2mfna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mfna1 b.1.2.1 (A:1-92) Fibronectin, different Fn3 modules {Mouse (Mus musculus) [TaxId: 10090]} gldsptgfdssditansftvhwvaprapitgyiirhhaehsvgrprqdrvppsrnsitlt nlnpgteyvvsiiavngreesppligqqatvs
Timeline for d2mfna1: