Lineage for d2mfna1 (2mfn A:1-92)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761880Protein Fibronectin, different Fn3 modules [49270] (3 species)
  7. 2761898Species Mouse (Mus musculus) [TaxId:10090] [49272] (2 PDB entries)
  8. 2761899Domain d2mfna1: 2mfn A:1-92 [21982]

Details for d2mfna1

PDB Entry: 2mfn (more details)

PDB Description: solution nmr structure of linked cell attachment modules of mouse fibronectin containing the rgd and synergy regions, 10 structures
PDB Compounds: (A:) Fibronectin

SCOPe Domain Sequences for d2mfna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mfna1 b.1.2.1 (A:1-92) Fibronectin, different Fn3 modules {Mouse (Mus musculus) [TaxId: 10090]}
gldsptgfdssditansftvhwvaprapitgyiirhhaehsvgrprqdrvppsrnsitlt
nlnpgteyvvsiiavngreesppligqqatvs

SCOPe Domain Coordinates for d2mfna1:

Click to download the PDB-style file with coordinates for d2mfna1.
(The format of our PDB-style files is described here.)

Timeline for d2mfna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mfna2