Lineage for d2mfn_1 (2mfn 1-92)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.2: Fibronectin type III [49265] (1 family) 
Family b.1.2.1: Fibronectin type III [49266] (14 proteins) 
Protein Fibronectin, different Fn3 modules [49270] (2 species) 
Species Mouse (Mus musculus) [TaxId:10090] [49272] (2 PDB entries) 
Domain d2mfn_1: 2mfn 1-92 [21982]
Details for d2mfn_1
PDB Entry: 2mfn (more details)
PDB Description: solution nmr structure of linked cell attachment modules of mouse fibronectin containing the rgd and synergy regions, 10 structures
SCOP Domain Sequences for d2mfn_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mfn_1 b.1.2.1 (1-92) Fibronectin, different Fn3 modules {Mouse (Mus musculus)}
gldsptgfdssditansftvhwvaprapitgyiirhhaehsvgrprqdrvppsrnsitlt
nlnpgteyvvsiiavngreesppligqqatvs
SCOP Domain Coordinates for d2mfn_1:
Click to download the PDB-style file with coordinates for d2mfn_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2mfn_1:
- d2mfn_1 appears in SCOP 1.57
- d2mfn_1 appears in the current release, SCOPe 2.08, called d2mfna1
View in 3D
