![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) ![]() |
![]() | Family d.157.1.3: ROO N-terminal domain-like [56291] (4 proteins) |
![]() | Protein automated matches [227097] (2 species) not a true protein |
![]() | Species Thermotoga maritima [TaxId:2336] [226498] (2 PDB entries) |
![]() | Domain d4dika1: 4dik A:-3-250 [219779] Other proteins in same PDB: d4dika2, d4dikb2 automated match to d1vmea2 complexed with cl, feo; mutant |
PDB Entry: 4dik (more details), 1.75 Å
SCOPe Domain Sequences for d4dika1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dika1 d.157.1.3 (A:-3-250) automated matches {Thermotoga maritima [TaxId: 2336]} hhhhmpkiwterifddpeiyvlridddriryfeavweipegisynaylvklnganvlidg wkgnyakefidalskivdpkeithiivnhtepdasgslpatlktighdveiiasnfgkrl legfygikdvtvvkdgeereiggkkfkfvmtpwlhwpdtmvtyldgilfscdvgggyllp eilddsnesvverylphvtkyivtvighyknyilegaeklsslkikallpghgliwkkdp qrllnhyvsvakgd
Timeline for d4dika1: